Author

Topic: [ANN] NVIS - Invisible internet - Pre-ICO Jun. 20 - Aug. 31 (Read 662 times)

member
Activity: 231
Merit: 10
A project with clear concept of ruling in the market of crypto. Definitely investing is a good option.
newbie
Activity: 47
Merit: 0
An amazing and very useful project. Successful development to you on the Internet.
newbie
Activity: 350
Merit: 0
This network could easily secure and enjoin the host nodes of ANY computer, device or private blockchain (institutional or enterprise) or public blockchain (i.e., Bitcoin, ethereum, Litecoin, Ripple, Dash, Zcash, Monero, etc.). Nodes are untraceable and rendered invisible to hackers, thieves or snooping from the public Internet, thereby reducing risk from exploits, denial-of-service downtime of strategically critical blockchain nodes that can impact cryptocurrency market operation and disrupt transactions
That what i was looking for since long time.. NVIS his on the way to realize it and that why i am involved in this project
newbie
Activity: 294
Merit: 0
It has tried and achieved the maximum possible security offering in a token.
newbie
Activity: 294
Merit: 0
I feel it is a well thought of project and lots and lots of man hours have gone into planning and structuring this Blockchain ecosystem.
newbie
Activity: 129
Merit: 0
The idea of blockchain VPNs is good, if the product application of the project is better than the current VPN services, you do not want to succeed as well!
I hope the project can launch the test product before the ICO takes place so the developer can take another step further.
Good luck!
newbie
Activity: 294
Merit: 0
From a security point of view what NVIS is providing is revolutionary in the sense of human psychology behind finances being safe.
hero member
Activity: 994
Merit: 500
Bring VPN to blockchain? Amazing idea to save our internet. Need to read and learn more about NVIS to understand your idea. Your Pre-ICO is running only on KickICO? How about 200 BTC planned on your website?
the idea is good but in fact we need a working product to check the security

MVP has easy setup with auto-provisioning on Windows, Linux, MacOSX. Current test network is operational, with primary nodes in Tokyo, US, Canada, Paris and Amsterdam and hundreds of VPNs.


nice that is good i should install and give a try . good luck
newbie
Activity: 308
Merit: 0
Bring VPN to blockchain? Amazing idea to save our internet. Need to read and learn more about NVIS to understand your idea. Your Pre-ICO is running only on KickICO? How about 200 BTC planned on your website?
the idea is good but in fact we need a working product to check the security

MVP has easy setup with auto-provisioning on Windows, Linux, MacOSX. Current test network is operational, with primary nodes in Tokyo, US, Canada, Paris and Amsterdam and hundreds of VPNs.
copper member
Activity: 364
Merit: 0
VPN on blockchain. Again an unique concept to look for. Need to go in deep to know more about this project and also the team looks strong enough in regards with their experience.
Improve security in cryptocurrencies transactions,is a wellcome development,i just hope that the team succeed and not just a scam project or hype in another way,more information are required from the team to have better understanding, i hope it work !
copper member
Activity: 364
Merit: 0
VPN is also a centralized model when it is managed by a company with a server cluster, they can steal information from the client. Blockchain technology is the most powerful solution to this problem. Just we need to understand more and more the protocol and how it works for the VPN market.
Blockchain industry is sure a solution to this problem, be part of this good idea and follow  it to full implementation with the help of community support,it is a win win for all.
copper member
Activity: 420
Merit: 26
I still think one of the best way to motivate bounty hunters is by allocating a reasonable amount to the bounty. Yes 1000 ETH has a long way to increase the interest of bounty hunters. So let's keep our fingers crossed and hope for the best for this project because from the look of things the team look solid with wide range of experience in the field and i trust them to live up to expectations for both investors and those of us that will gladly participate in the progress and in support of this project.
member
Activity: 378
Merit: 19
You are allocating a huge number of reward for the bounty campaign, planned for about 1000ETH allocated for the bounty campaign, even though your hardcap is just 5000ETH.
I think that is a really big number of allocation, all the bounty participant will be happy about it.
I think 1000 ETH is in the best plan from NVIS, including bonus/referral tokens.
We are waiting for their bounty campaign too, hope it is a big bounty to join and support this Project.
copper member
Activity: 364
Merit: 0
NVIS project will be among the best projects in 2018,going  through their roadmap and the video as well gives a better understanding of the project, in any online transaction security is paramount, i hope the team make this a reality. Good luck.
jr. member
Activity: 73
Merit: 1
Theory is so but I think it all depends on the actual product. but of course I think from the good idea will be able to go to good product!
jr. member
Activity: 73
Merit: 1
"Hackers can't hack what they can not see" this sounds great! but need time and also depend on the way they process!
copper member
Activity: 364
Merit: 0
The networks of VPN as a invisible internet with his own domain name registered services, dynamic host configuration protocol  (DHCP) and distributed firewalls to enhance security with high performance in allowing users to carry out transactions in blockchain industry,interesting concept! Good luck.
newbie
Activity: 308
Merit: 0
When everything is said and done, this project is definitely innovative. It’s a very innovative attempt to create a fully-fledged network of VPNs to make sure that the experience of surfing web remains completely secure. Plus, the participating nodes will get incentivized for whatever work they’re performing on the network.
member
Activity: 266
Merit: 10
I want to ask you.. heave you already exploited the units? Gave you made any experiments? I would like to know the results of calculation! I mean, what you have obtained, talking about the economic indicators
hero member
Activity: 994
Merit: 500
Bring VPN to blockchain? Amazing idea to save our internet. Need to read and learn more about NVIS to understand your idea. Your Pre-ICO is running only on KickICO? How about 200 BTC planned on your website?
the idea is good but in fact we need a working product to check the security
newbie
Activity: 167
Merit: 0
People,don't miss a good chance to make easy money.I like this.
newbie
Activity: 308
Merit: 0
The sheer number of tokens available makes this project quite enticing for crypto investors. Combine the number of tokens with the added referral commissions and this seems like a good potential investment opportunity for 2108. Unlike many start-ups that look to crypto funding campaigns, the NVIS platform offers a smarter option for investing that is more likely to payout than a startup idea that has not yet been tested.
copper member
Activity: 364
Merit: 0
Solution - good. The last problem is team info, need to check team to invest in this project. And partners too. We need an article, which show: HP and others are working with you, how they can help you in future.

Correct! More information is required specially your partners and way forward , well let keep our fingers crossed and hope they meet the soft cap,and maybe after then more information will be made available,i believes in this project and hope to see the full implementation.
copper member
Activity: 364
Merit: 0
The hardest part is always to get the community behind your project. How do you plan to let people switch to join TSN and use the TLC tokens (NVIS) for access and to support the infrastructure expansion and operation?

It's a fantastic idea and interesting concept in the blockchain industry bringing invisible internet as a  distributed network of VPN with decentralized management powered by blockchain, taking a look at their partners, i believe the team is going to do well,so with this the community will strongly behind this project.
newbie
Activity: 308
Merit: 0
Solution - good. The last problem is team info, need to check team to invest in this project. And partners too. We need an article, which show: HP and others are working with you, how they can help you in future.

John Matthesen serves as the CEO and brings his experience and expertise from his successful development of two startup to IPO companies. Combining his experience with both Commerce One and Sybase alongside extensive experience throughout the United States, Europe, and Asia John is prepared to lead the TLC Team to success. Phil Smith serves as the Chief Technical Officer and President. Phil is a network security expert and has worked at senior levels previously with Hewlett Packard, NASA, and Cisco.
Full team member biographies are available through the NVIS website at www.nvis.info/.
newbie
Activity: 382
Merit: 0
If this project will push trough, I am gonna make a big savings using NVIS. Internet providers in my country just love to rob our money providing superslow internet connection for an unreasonable cost. The crypto market is red, hope NVIS can achieve their hardcap. Getting more advertisements is a must. Goodluck!
copper member
Activity: 364
Merit: 0
I think this is a good way to solve network security problems. We are facing many threats, especially when the scientific revolution is exploding. Besides, we see the huge potential of this project. hope the project will succeed

I hope so, introducing VPN service into blockchain thereby to improves the uptime and performance of blockchain nodes for consumers service is a good one to enhance transactions.
copper member
Activity: 364
Merit: 0
NVIS has an interesting roadmap. What are your marketing plans to grow in terms of customer base?
Currently, TSN has bootstrap nodes where?


I guess as well,the roadmap shows the team as the manpower/expertise to excuse this great project and to bring a change in the blockchain industry, Good luck team.
sr. member
Activity: 742
Merit: 250
You are allocating a huge number of reward for the bounty campaign, planned for about 1000ETH allocated for the bounty campaign, even though your hardcap is just 5000ETH.
I think that is a really big number of allocation, all the bounty participant will be happy about it.
newbie
Activity: 308
Merit: 0
I really enjoy the apply of blockchain technology in life.The idea of the project look like is the next generation of internet. Like Sillicon Vally film series which they build decentralized internet. Keep going on guys, blockchain are now lead the technology, I like this platform.
newbie
Activity: 32
Merit: 0
will the unsold tokens be burnt after ico?
member
Activity: 378
Merit: 19
We all know that this project is very good and has a future, but it is very difficult to build a community of supporters and investors. It depends on many different factors!
At the moment, I think NVIS problems are team info, partnership and investment, although their idea and solutions are potential.
Investor don't want to invest in high-risk ICO when market is RED.
jr. member
Activity: 73
Merit: 1
We all know that this project is very good and has a future, but it is very difficult to build a community of supporters and investors. It depends on many different factors!
newbie
Activity: 308
Merit: 0
The hardest part is always to get the community behind your project. How do you plan to let people switch to join TSN and use the TLC tokens (NVIS) for access and to support the infrastructure expansion and operation?
member
Activity: 378
Merit: 19
As you see, NVIS expaned their Pre-ICO on KickICO to 31.08. Hope they can reach softcap 500 ETH soon.
About project future: we will have real distributed VPN network to use and be save in internet.
member
Activity: 182
Merit: 10
I've already seen a project about creating blockchain-based VPN connections for a secure, anonymous Internet connection using the Mysterium network in 2017.
jr. member
Activity: 73
Merit: 1
I am really exciting to join this project! I wish i can start now 🙃! And i am sure that this project will be succeeded!
newbie
Activity: 308
Merit: 0
Hi guys, when NVIS succeeds in ICO, what will happen to NVIS's future and development plans in the future?
Do i need to register my name to join? And I would like to ask what is your vision about NVIS in 5 years?
member
Activity: 210
Merit: 13
TLC Secure, Inc. (herein “Operating Company”), is a software company headquartered in California, USA. TLC is designated to implement the development of technology known as “Invisible Internet”(trademark 87681181). Any token sales and distribution are between Mascot Enterprises (herein “Token Issuer”), a business in
Karachi, Pakistan, and you, as a Participant and so on....... So i dont get it, what country is this project is comming from? Pakistan of USA?
hero member
Activity: 592
Merit: 500
I just watched your NVIS router demo 2 video and I must say how perfect its functioning. One can connect all the devices including smartphones and tablets to NVIS network by using NVIS router. Just watch the demo for better understanding.

Yeah pure gold lol. Its trolling shit video with two dudes getting into argument of whom one is trying to placate the other, and the counterpart is casting reproach on to the cool dude. The reason of disagreement is that first dude farted and his buddy cant stand it thus reprimands first dude earnestly.
jr. member
Activity: 73
Merit: 1
We can connect on many devices that means we can use anywhere we want! That’s so good they are making the same processing way with Apple.
newbie
Activity: 294
Merit: 0
I just watched your NVIS router demo 2 video and I must say how perfect its functioning. One can connect all the devices including smartphones and tablets to NVIS network by using NVIS router. Just watch the demo for better understanding.
newbie
Activity: 308
Merit: 0
Hi guys, when NVIS succeeds in ICO, what will happen to NVIS's future and development plans in the future?
member
Activity: 378
Merit: 19
I wish NVIS hit the cap soon so that they can start the development making it a success and also i am eagerly waiting for its bounty to start so that i can earn some NVIS. Such projects should not be missed!
They need to reach softcap 500 ETH to continue work, develop project and bring VPN on blockchain for crypto-community.
You can check their funding on KickICO here: https://www.kickico.com/ru/campaigns/22452/nvis-the-invisible-internet-be-a-part-of-it
I think NVIS hit the cap soon - 500 ETH. Remember that their total supply is only 100 000 000 NVIS. Small supply, big demand. That is golden rule of market.
Yeah, softcap is important for every project. It is min condition to bring project from idea to solution and product. And investors usually buy tokens after softcap.
We wait for their ICObench rating too. Community can check their profile and join then invest.
newbie
Activity: 294
Merit: 0
NVIS roadmap is upto 2020 and this shows the team is willing to work for long time. Project need some more media coverage to boost up the sales for soft cap.
jr. member
Activity: 73
Merit: 1
This is good project so i think there are many people will invest their money and time on this one! I hope this project will grow quickly and i am sure about that!
newbie
Activity: 308
Merit: 0
NVIS has an interesting roadmap. What are your marketing plans to grow in terms of customer base?
Currently, TSN has bootstrap nodes where?
copper member
Activity: 364
Merit: 0
I think this is a wellcome idea in the blockchain industry and from what i have seem,the team have the expertise to deliver this project and make it a reality for users, NVIS to provide a  peer to peer connection using layer 2 over layer 3 VPN to provide quality and secure mode of transaction ?, it's a good idea for this crypto world we are,where rate of hackers is on high increase day by day.Good luck team.
brand new
Activity: 0
Merit: 0
I wish NVIS hit the cap soon so that they can start the development making it a success and also i am eagerly waiting for its bounty to start so that i can earn some NVIS. Such projects should not be missed!
They need to reach softcap 500 ETH to continue work, develop project and bring VPN on blockchain for crypto-community.
You can check their funding on KickICO here: https://www.kickico.com/ru/campaigns/22452/nvis-the-invisible-internet-be-a-part-of-it
how do we know that how many eth they are invested
jr. member
Activity: 73
Merit: 1
nowadays, there are so many projects and also many fakes project or scams! really hard to find out some project to spend our time and hope one day hardwork payoff! i trust this one!
newbie
Activity: 308
Merit: 0
I wish NVIS hit the cap soon so that they can start the development making it a success and also i am eagerly waiting for its bounty to start so that i can earn some NVIS. Such projects should not be missed!
They need to reach softcap 500 ETH to continue work, develop project and bring VPN on blockchain for crypto-community.
You can check their funding on KickICO here: https://www.kickico.com/ru/campaigns/22452/nvis-the-invisible-internet-be-a-part-of-it
I think NVIS hit the cap soon - 500 ETH. Remember that their total supply is only 100 000 000 NVIS. Small supply, big demand. That is golden rule of market.
member
Activity: 378
Merit: 19
I wish NVIS hit the cap soon so that they can start the development making it a success and also i am eagerly waiting for its bounty to start so that i can earn some NVIS. Such projects should not be missed!
They need to reach softcap 500 ETH to continue work, develop project and bring VPN on blockchain for crypto-community.
You can check their funding on KickICO here: https://www.kickico.com/ru/campaigns/22452/nvis-the-invisible-internet-be-a-part-of-it
newbie
Activity: 294
Merit: 0
I wish NVIS hit the cap soon so that they can start the development making it a success and also i am eagerly waiting for its bounty to start so that i can earn some NVIS. Such projects should not be missed!
member
Activity: 378
Merit: 19
Feeling really a quality project, promising. I want be a Service provider. How can i be paid for services?
I think we can join blockchain and provide our service to earn NVIS tokens for it.
Hope they can reach caps to have funds to start developing.
newbie
Activity: 308
Merit: 0
Feeling really a quality project, promising. I want be a Service provider. How can i be paid for services?
newbie
Activity: 91
Merit: 0
I think this is a good way to solve network security problems and roadmap NVIS 2020 development pproject....
member
Activity: 378
Merit: 19
Solution - good. The last problem is team info, need to check team to invest in this project. And partners too. We need an article, which show: HP and others are working with you, how they can help you in future.
jr. member
Activity: 73
Merit: 1
I think this is a good way to solve network security problems. We are facing many threats, especially when the scientific revolution is exploding. Besides, we see the huge potential of this project. hope the project will succeed
Yeah, I am using VPS for my work, But I'm still not satisfied . I hope that this project will update and resolve any prolems. I really care about its price, security , how many IP we will be provided, etc...

exactly! This is only the original orientation of the project. Sure, they will improve the product more and I think it will bring real value.
newbie
Activity: 308
Merit: 0
VPN is also a centralized model when it is managed by a company with a server cluster, they can steal information from the client. Blockchain technology is the most powerful solution to this problem. Just we need to understand more and more the protocol and how it works for the VPN market.
Yes, i agree. Other VPNs (like SSL or IPSec) are still be visible on the public internet. Although they may be encrypted, they are still vulnerable to things like Distributed Denial of Service (DDOS) and Man-in-the-Middle (MITM) attacks.
hero member
Activity: 1022
Merit: 500
Because i have hp i am partner?
newbie
Activity: 294
Merit: 0
Already partnered with HP is already a big thing. Looking forward for more big partnerships which will surely rocket this project. If the team gets more big partnerships, then this could be a one of the biggest projects of 2018/19. Wish to see more from the team. Good Luck.
newbie
Activity: 308
Merit: 0
The idea is very unique. Each can run web servers, information servers, content services that can be shared with all members as if they were on the public Internet, or a more selective community of nodes. Joining your computer or IoT device to a community will be much like joining a chat room or social media. It’s a genuine social network for computers.
Be a part of this incredible project.
newbie
Activity: 249
Merit: 0
I believe this project has a good future because Zeepin has a complete foundation. I'm taking some great bonuses. good luck!
brand new
Activity: 0
Merit: 0
I think this is a good way to solve network security problems. We are facing many threats, especially when the scientific revolution is exploding. Besides, we see the huge potential of this project. hope the project will succeed
Yeah, I am using VPS for my work, But I'm still not satisfied . I hope that this project will update and resolve any prolems. I really care about its price, security , how many IP we will be provided, etc...
member
Activity: 378
Merit: 19
VPN is also a centralized model when it is managed by a company with a server cluster, they can steal information from the client. Blockchain technology is the most powerful solution to this problem. Just we need to understand more and more the protocol and how it works for the VPN market.
jr. member
Activity: 73
Merit: 1
A solid team comprised of technical, business experts and is extremely experienced. I like that. I hope this project will be one of the best in the near future.
yeah, i have the same thought with you. i think the team was doing really well and you can see a brilliant future of this project. moreover, i hope they will succeed!
member
Activity: 378
Merit: 19
I think this is a good way to solve network security problems. We are facing many threats, especially when the scientific revolution is exploding. Besides, we see the huge potential of this project. hope the project will succeed
Are you using VPN or fake IP software? Do you think it is save for you and your data?
Just for me: i think it is not save, when VPN can save my history  private key + data, just is save from governments when they can't check my ID.
I worked in FBA, sold products on Amazon, and need to have VPN to online 24/7.
Wait for NVIS solution and their product, not just MVP, after token-sale.
newbie
Activity: 135
Merit: 0
I like this project, I will wait to develop more on this project.
jr. member
Activity: 73
Merit: 1
I think this is a good way to solve network security problems. We are facing many threats, especially when the scientific revolution is exploding. Besides, we see the huge potential of this project. hope the project will succeed
member
Activity: 378
Merit: 19
I looked at the road map and I must say its simple and to the point. You guys have already pretty much developed and expanded the project before going into the pre-sale and this is a good sign.
Their roadmap is to 2020, do you think it is short for a crypto/blockchain project? I want to read detailed roadmap, what will they do, which partners do they want to buring VPN to blockchain and issue tokens for payment method.
newbie
Activity: 308
Merit: 0
A solid team comprised of technical, business experts and is extremely experienced. I like that. I hope this project will be one of the best in the near future.
newbie
Activity: 294
Merit: 0
I looked at the road map and I must say its simple and to the point. You guys have already pretty much developed and expanded the project before going into the pre-sale and this is a good sign.
newbie
Activity: 62
Merit: 0
This doesn't look super legit..
brand new
Activity: 0
Merit: 0
Great project! It looks a special project with a really promising potential. I advise everyone to join and to watch the development!
I joined
member
Activity: 378
Merit: 19
Good concept. Does this project have a bounty campaign? I would love to join for the bounty.

At the moment there is Ref-program from NVIS: https://twitter.com/BountyTreesDrop/status/1013576501676081154
Hope they have successful Pre-ICO, then thay can launch Bounty-campaign to promote project to crypto-community.
newbie
Activity: 266
Merit: 0
Good concept. Does this project have a bounty campaign? I would love to join for the bounty.
newbie
Activity: 294
Merit: 0
VPN on blockchain. Again an unique concept to look for. Need to go in deep to know more about this project and also the team looks strong enough in regards with their experience.
newbie
Activity: 308
Merit: 0
Bring VPN to blockchain? Amazing idea to save our internet. Need to read and learn more about NVIS to understand your idea. Your Pre-ICO is running only on KickICO? How about 200 BTC planned on your website?

I have been following this project for a while and I can attest to the fact that this is one of the most transparent and legit projects, aimed to protect both individual and corporate profiles on the internet/intranet. All it needs is more publicity on how it works.
I checked their Pre-ICO on KickICO, I think KickICO checked their info too, but I'm waiting for their info and their listing on ICObench/ICOholder/trackICO with high rating scores. At the moment VPN is a part of our life and internet, it is cool if they can bring it to blockchain.

The Global Information Security Workforce Study 2017 report from Frost & Sullivan and the International Information Systems Security Certifications Consortium Inc. states that unfilled jobs in Cybersecurity will be over 1.8 million by 2022.
This shows that hacking is a problem hacking is a problem, not only for existing software companies, but also for blockchain companies. This is a problem, I hope NVIS is a solution!
jr. member
Activity: 73
Merit: 1
In the context of network security being put at the top of current companies, the solution NVIS offered is entirely feasible and highly applicable. And I think this can be used more extensively!
newbie
Activity: 308
Merit: 0
Today’s digital financial markets are growing at an exponential rate and hackers now have more advanced techniques and equipment than ever before.
So, why TSN can resistant to hackers? Why is TSN called the Invisible Internet?
member
Activity: 378
Merit: 19
Bring VPN to blockchain? Amazing idea to save our internet. Need to read and learn more about NVIS to understand your idea. Your Pre-ICO is running only on KickICO? How about 200 BTC planned on your website?

I have been following this project for a while and I can attest to the fact that this is one of the most transparent and legit projects, aimed to protect both individual and corporate profiles on the internet/intranet. All it needs is more publicity on how it works.
I checked their Pre-ICO on KickICO, I think KickICO checked their info too, but I'm waiting for their info and their listing on ICObench/ICOholder/trackICO with high rating scores. At the moment VPN is a part of our life and internet, it is cool if they can bring it to blockchain.
newbie
Activity: 39
Merit: 0
Bring VPN to blockchain? Amazing idea to save our internet. Need to read and learn more about NVIS to understand your idea. Your Pre-ICO is running only on KickICO? How about 200 BTC planned on your website?

I have been following this project for a while and I can attest to the fact that this is one of the most transparent and legit projects, aimed to protect both individual and corporate profiles on the internet/intranet. All it needs is more publicity on how it works.
member
Activity: 378
Merit: 19
Bring VPN to blockchain? Amazing idea to save our internet. Need to read and learn more about NVIS to understand your idea. Your Pre-ICO is running only on KickICO? How about 200 BTC planned on your website?
jr. member
Activity: 53
Merit: 1

NVIS

A Distributed Network of VPNs
The Invisible Internet™


Pre-ICO is LIVE
》》》 《《《


WEBSITEBOUNTYWHITEPAPERTELEGRAMTWITTERFACEBOOK
SLACKMEDIUMYOUTUBE


🔊    Official NVIS ANN thread    🔊

Official NVIS Bounty campaign : NVIS Tokens (~1000 ETH) are waiting for you!
https://twitter.com/BountyTreesDrop/status/1013576501676081154

========================================
ICO CAPS

Softcap: 500 ETH
Hardcap: 5 000 ETH




TOKEN SALE SCHEDULE

🌟🌟🌟 Pre-Sale: 20.06.2018 - 31.08.2018 | Price : 1 NVIS = 0.012-0.017 ETH 🌟🌟🌟
Main-Sale: N/A | Price : N/A

========================================

Other Languages
(Links will be updated after the translation)
------------------
.• Chinese : (ANN, Whitepaper)
• Arabic : (ANN, Whitepaper)
• Japanese : (ANN, Whitepaper)
• Russian : (ANN, Whitepaper)
• Korean : (ANN, Whitepaper)
• Spanish : (ANN, Whitepaper)
• Vietnamese : (ANN, Whitepaper )
• German : (ANN, Whitepaper )




PROBLEM
______________


Despite the blockchain scale, nodes are individually subject to Denial of Service attacks that can take down strategically significant nodes and risk overwhelming other nodes as transactions are processed suboptimally. Vulnerabilities in TCP/IP network services can be a major weakness in blockchain networks. Network vulnerability scanners, such as Nessus by Tenable, and online databases, including Common Vulnerabilities and Exposures (CVE) contain thousands of publicly known vulnerabilities, exploits, backdoors, and trojans in network services and applications. The Internet is founded on TCP/IP, and the vast body of network implementations and applications make it infeasible to use other protocols. Because of the diversity of hosts and network configurations, each blockchain node is managed by different individuals and organizations that have wide variance in the level of sophistication of administrators with respect to network security.

More of our lives are transferred onto the Internet daily. This creates more opportunity for our data to be stolen, hacked, filtered or misused. Privacy has become almost impossible. There is also increased data vulnerability. One of the main forces driving the market for privacy and security solutions is the vast market to collect or steal and sell personal information.

VPN can be used to provide a security layer to both private and public networks such as WiFi Hotspots and the Internet. Organizations operating in healthcare and telecommunication industry deal with sensitive information that needs to be protected constantly. Hackers are mostly targeting these industries due to very high price of data in black market. The same study shows that “currently, the world is experiencing more than half million attacks every minute, which will rise due to high technology proliferation”.





SOLUTION
______________


The solution NVIS proposes is to have a blockchain with integrated peer-to-peer Layer 2 encryption between nodes. Product, SafeConnect L2P2P is a layer 2 over layer 3 VPN so from the inner perspective of the node, all ports are available.

From the outer perspective of the node (the Internet side), all TCP ports are closed and filtered by iptables, except for the port used as a funnel for communication with a named community of peers.

The benefits of this architecture include:

   ●   Reducing the outside attack surface
   ●   Cloaking inter-node communication
   ●   Normal intra-node communication
   ●   Sealing all unused ports
   ●   Eliminating threat of external packet-injection
   ●   Improves the uptime and performance of blockchain nodes




HOW IT WORKS
______________

VPN service consumer find and pay service providers in TLC SafeConnect Network by using built-in smart contract based Identity, Service Discovery and Payment services. The network itself is cloaked, and nodes use the Ethereum blockchain for censorship resilient distributed storage and transactional processing needs. The TLC SafeConnect Network will use Registered Identities to enable means of creating limited trust when engaging with services and account payments.


Core components:

   ➢   Ethereum allows the TLC SafeConnect Network to run decentralized code with smart contracts, enabling reliable services and payment handling.
   ➢   Identity service and database of registered identities will be added to ensure the proper identity acknowledgement between client and service provider.
   ➢   Discovery service and database of available services will be created to announce VPN services availability.
   ➢   Payment service and database of balances will be developed to secure promise-based micropayments for services.



00000000000000000000000000000


Jump to:
© 2020, Bitcointalksearch.org